I have just updated to BOINC ver. 7.0.25. However, computation errors happened with all 7 work units (6 out of them were newly downloaded ones since the update). Should I revert to the old version 6.12.34?

---

It looks as though there must be some problem work units out there. As your failures were reported, the tasks were reissued to other machines and failed there as well under various BOINC versions.

Is anyone else having problems with task names starting with "rb_04_12" & "rb_04_13"??

---

Rosetta Moderator: Mod.Sense

It looks as though there must be some problem work units out there. As your failures were reported, the tasks were reissued to other machines and failed there as well under various BOINC versions.

Is anyone else having problems with task names starting with "rb_04_12" & "rb_04_13"??

I have been getting several computation errors since I installed Boinc 7.0.25 x(64). The latest starts with aa_centroid_cst.

---

I am experiencing the same issue with 7.0.25 (x64). Of my most recent 84 tasks, 66 have computation errors with only 18 successes.

Cheers,

Adrian

I too can verify that since upgrading to Boinc 7.0.25 (x64) most of my work units have computation errors.

---

I have been having the same problem with BOINC 7.0.25 (WinXP 64 bit). Any ideas on a fix?

I'm crunching Rosetta on a 32bit machine, so I don't think the 64 bit argument below can be valid.

Yesterday 27/4/2012 I was getting more and more client errors using BOINC 7.0.025.

In frustration I stopped my crunching with Rosetta and replaced BOINC with version 6.12.34 which can still be downloaded from the BOINC website.

Since then, I have had no client errors.

So on conclusion, something seems amiss with BOINC 7.0.25 and Rosetta.

My other 2 64bit computers are crunching other projects seperatley and are not experiencing any issues with BOINC 7.0.25 yet !

Its a temporary solution, in my case, and I hope it helps others, until the situation is resolved.

Swordfish
ps apologies to moderators for posting originally in wrong thread

Since BOINC 7 has come out there have been some people that are having issues with tasks erroring out or running high priority all the time and grabbing all the cores in the process. On another project someone has posted this issue on the BOINC error board and has heard back that BOINC will put the fix in the next version, whenever that is. So you might as well stay with Version 6 for now until the next version of BOINC comes out.

Same here ! Just installed the latest version of BOINC, and most of the tasks from Rosetta end up with Computation Error, with is not the case with other projects: Milkyway, Einstein, Orbit, SETI, Cosmology - they have no errors at all.
I run Win7 64 bit.

Same here ! Just installed the latest version of BOINC, and most of the tasks from Rosetta end up with Computation Error, with is not the case with other projects: Milkyway, Einstein, Orbit, SETI, Cosmology - they have no errors at all.
I run Win7 64 bit.

Just set your projects to no new work. Finish what you have and then go back to version 6 if you want to keep running all projects without errors.

Same here ! Just installed the latest version of BOINC, and most of the tasks from Rosetta end up with Computation Error, with is not the case with other projects: Milkyway, Einstein, Orbit, SETI, Cosmology - they have no errors at all.
I run Win7 64 bit.

Rosetta has a known problem with the version 7 series of Boinc, stop using it or find another project until they fix it is my suggestion.

Get it as regular as clock work. It turns out to be a missing file (usually .ini)
so although the wu has been completed it cant wright to the .ini file as the address quoted is not their it is in another file or folder address or in deed missing altogether.

---

I was getting errors on 7.0.25 and then 7.0.26, but I have since changed to 7.0.27 and things are much better. gone from about 50% error to about 2 in two days. I also switched Rosetta preferences to 1hr/WU. On the errors left, it seems to be happening after 'Setting up graphics native'

...
Unpacking zip data: ../../projects/boinc.bakerlab.org_rosetta/minirosetta_database_rev48292.zip
Setting database description ...
Setting up checkpointing ...
Setting up graphics native ...
EFPCWLVEEFVVAEECSPCSNFRAKTTPECGPTGYVEKITCSSSKRNEFKSCRSALME
can not find a residue type that matches the residue PRO_p:pro_hydroxylated_case1at position 3

ERROR: core::util::switch_to_residue_type_set fails

ERROR:: Exit from: ......srccoreutilSwitchResidueTypeSet.cc line: 143
BOINC:: Error reading and gzipping output datafile: default.out
called boinc_finish

</stderr_txt>

Using on both computers:
Phenom IIs
Windows 7 64
AMD HD5870 on one shrubbing MilkyWay, HD5770 on another shrubbing POEM.

Just my observations.

I've just gone back to version 7.026 and I'm getting errors again.

As i'm not prepared to waste anymore valuable computing time on unpredictable results, I've detatched from the project until matters are resolved.

Yes I could go back to version 6.xxx as I did do earlier in this thread, but I'm not faffing around anymore.

I dont have any problems with Seti, on all 3 of my machines running 7.026, and that where I will stay until this is sorted.

Swordfish

I'm having about a 2/3'rd failure rate on ALL my Rosetta work units since the 7.0.25 Boinc update. Reports back Client Error and Compute Error. This version of Boinc and my CPU are fine with SETI work units on all cores so I think the problem is specific to the Rosetta project and this latest update. Is this on the radar? Is a fix at hand? Here's what's reported from my most recent failed work unit:

509376616
Name jsr_decoys_centroid_2oss_SAVE_ALL_OUT_50596_640_0
Workunit 464057852
Created 30 May 2012 6:00:33 UTC
Sent 30 May 2012 6:01:11 UTC
Received 30 May 2012 19:41:14 UTC
Server state Over
Outcome Client error
Client state Compute error
Exit status 1 (0x1)
Computer ID 1488309
Report deadline 9 Jun 2012 6:01:11 UTC
CPU time 6682.552
stderr out <core_client_version>7.0.25</core_client_version>
<![CDATA[
<message>
Incorrect function. (0x1) - exit code 1 (0x1)
</message>
<stderr_txt>
[2012- 5-30 10:14:10:] :: BOINC:: Initializing ... ok.
[2012- 5-30 10:14:10:] :: BOINC :: boinc_init()
BOINC:: Setting up shared resources ... ok.
BOINC:: Setting up semaphores ... ok.
BOINC:: Updating status ... ok.
BOINC:: Registering timer callback... ok.
BOINC:: Worker initialized successfully.
Registering options..
Registered extra options.
Initializing broker options ...
Registered extra options.
Initializing core...
Initializing options.... ok
Options::initialize()
Options::adding_options()
Options::initialize() Check specs.
Options::initialize() End reached
Loaded options.... ok
Processed options.... ok
Initializing random generators... ok
Initialization complete.
Initializing options.... ok
Options::initialize()
Options::adding_options()
Options::initialize() Check specs.
Options::initialize() End reached
Loaded options.... ok
Processed options.... ok
Initializing random generators... ok
Initialization complete.
Setting WU description ...
Unpacking zip data: ../../projects/boinc.bakerlab.org_rosetta/minirosetta_database_rev48292.zip
Unpacking WU data ...
Unpacking data: ../../projects/boinc.bakerlab.org_rosetta/2oss_homfrags.zip
Setting database description ...
Setting up checkpointing ...
Setting up graphics native ...
Setting up folding (abrelax) ...
Beginning folding (abrelax) ...
BOINC:: Worker startup.
Starting watchdog...
Watchdog active.
Starting work on structure: _00001
Starting work on structure: _00002
Starting work on structure: _00003
Starting work on structure: _00004
Starting work on structure: _00005
Starting work on structure: _00006
Starting work on structure: _00007
Starting work on structure: _00008
Starting work on structure: _00009
Starting work on structure: _00010
Starting work on structure: _00011

</stderr_txt>
]]>


Validate state Invalid
Claimed credit 68.5895906965126
Granted credit 0
application version 3.31

I'm having about a 2/3'rd failure rate on ALL my Rosetta work units since the 7.0.25 Boinc update. Reports back Client Error and Compute Error. This version of Boinc and my CPU are fine with SETI work units on all cores so I think the problem is specific to the Rosetta project and this latest update. Is this on the radar? Is a fix at hand?

NO...Rosetta does NOT support the Version 7 series of Boinc and has NO PLANS to change anything! They are quite happy with how things are going right now. Many of us have moved on to other projects as a result.

I'm having about a 2/3'rd failure rate on ALL my Rosetta work units since the 7.0.25 Boinc update. Reports back Client Error and Compute Error. This version of Boinc and my CPU are fine with SETI work units on all cores so I think the problem is specific to the Rosetta project and this latest update. Is this on the radar? Is a fix at hand?

NO...Rosetta does NOT support the Version 7 series of Boinc and has NO PLANS to change anything! They are quite happy with how things are going right now. Many of us have moved on to other projects as a result.

But...i have 7.0.25 boinc version on my win 7 machine. I run now rosetta and all working fine. What i have done wrong because all working fine?

NO...Rosetta does NOT support the Version 7 series of Boinc and has NO PLANS to change anything! They are quite happy with how things are going right now. Many of us have moved on to other projects as a result.

I should point out that mikey is speaking for himself and not for Rosetta@home. Mikey's comments are based on observation, without knowledge of the project's intentions.

---

Rosetta Moderator: Mod.Sense

NO...Rosetta does NOT support the Version 7 series of Boinc and has NO PLANS to change anything! They are quite happy with how things are going right now. Many of us have moved on to other projects as a result.

I should point out that mikey is speaking for himself and not for Rosetta@home. Mikey's comments are based on observation, without knowledge of the project's intentions.

You are more than welcome to say that but the Admin Michael said the same thing in one of his messages! Now it could be he has no clue either but one would think an Admin posting as an Admin would be responsible!

guys, same here, since update i been getting lots of troubles!!, 90% of my tasks finish with computer errors!! :(

u can see it here: https://boinc.bakerlab.org/rosetta/results.php?hostid=1531171

with my others pc with older versions of boinc its working great.

is there any admin information why this isnt working fine??, should i change proyect or dowload older version?... btw... where i can get an older version of boinc ?

thanks!

---